🇺🇸 English
JustPornFlix
Log inSign up
Menu
HomeLatestTop RatedMost ViewedCategoriesModelsTags
HomeLatestTop RatedMost ViewedCategoriesModelsTags
Home›Videos

Mark Troy - Axel Brown

4:130% rating
Share
Share this video

Muscle boy Axel Brown could theoretically kick young Mark Troy's ass when the boy catches him looking at gay porn on his laptop, but that wouldn't serve either of their interests in this Jawked video.It turns out, to absolutely no one's surprise, that god looking Mark is more interested in getting his buddy's mouth on his own cock now that he knows his friend is into it. He tries to act like he's shocked or something, but his pink meat is already solid the second he gets it out for Axel to suck on.The jock boy does a good job, licking that meat and slurping the shaft, playing with his balls and gobbling his inches deep.If Mark was going to try to persist with his rouse of surprise he soon fails when he gets his own mouth around Axel's cock. Maybe he planned to just let his gay buddy service him but when the offer of a cock to suck is right there he can't seem to resist the opportunity.That's not the only thing he can't resist.With Axel's tight muscle ass more than capable of handling his big cock and loaded balls he pumps his raw meat between those muscled cheeks and spoons his buddy before taking him from behind and banging him on his back.Mark's balls slap and swing with the pumps of his hips while he gives his friend the fucking he clearly needed, making Axel spew a heavy mess of semen all over his tanned abs and chest, slinging that spooge all over himself.He's not the only one with a lot of cock cream to deliver. When mark pulls out and moves up to his friend's handsome face he douses him with a fountain of spunk and gives the muscle boy some extra protein.

Models

Axelbig cockCreammuscle

Categories

AssBallsBig CockcockFuckingGaygay porngay teensjockslickingMusclemuscledmusclespornrawslurpingSucktannedtightvideoyoung

Tags

18+ youngabsabsolutelyalreadyassaxelbackballsbangingbigbig cockboybrownbuddycatchescheekscockcreamdeepextrafacefailsfountainfriendfrom behindfuckinggaygay porngodgoodgood jobhandlinghandsomeheavyhipsig cockinchesjobjockjockskicklaptoplickingloadedlookinglotmakingmaybemeatmessmoremouthmusclemuscle assmuscledmusclesofferonepinkplayingpornproteinpumpsrawraw meatresistrightsecondsemenserveserviceshaftshockedslapslurpingsolidsoonspoogespoonsspunksucksurpriseswingtakingtannedthingtighttryvideo

Community

Comment and reply.

Loading community...

Related Videos

12 shown
Florian Mraz - Axel Brown4:13100%

Florian Mraz - Axel Brown

Axel, Cream, Delicious, Mind, muscle

Maximum Pleasure! Hot Blonde MILF Gives A Wild Ride To Her Man's Big Dick4:130%

Maximum Pleasure! Hot Blonde MILF Gives A Wild Ride To Her Man's Big Dick

Cream, Delicious

Simon Best - Axel Brown4:130%

Simon Best - Axel Brown

Axel, Delicious, muscle, Simon

Florian-Mraz_MarkTroy\_HotBodiesFucking4:13100%

Florian-Mraz_MarkTroy\_HotBodiesFucking

muscle, Rod

Karl Stevens - Rex Lima4:130%

Karl Stevens - Rex Lima

big cock, Cream, czech, Don, muscle, Rimming

Alex Vens - Max Royse4:130%

Alex Vens - Max Royse

Delicious, Max, Mind

RonNegga-SimonBest : Hot Sexual Encounters Compilation4:130%

RonNegga-SimonBest : Hot Sexual Encounters Compilation

May, Simon

Finn Harper - Joaquin Santana4:150%

Finn Harper - Joaquin Santana

Cream, Delicious, Harper, rub

Mark-Troy's-BastionKarims-SexualAdventure" or "HotAndSteamyNightWithMalePornStars4:1350%

Mark-Troy's-BastionKarims-SexualAdventure" or "HotAndSteamyNightWithMalePornStars

Adam Shaw - Jamie Kelvin4:130%

Adam Shaw - Jamie Kelvin

Cream

Hot MILF Teaser - Sexy Brunette Mom Fucks Her Step-Son's Friend In The Ass4:130%

Hot MILF Teaser - Sexy Brunette Mom Fucks Her Step-Son's Friend In The Ass

Axel, Delicious, Juicy

Rough & Raw - Anal Threesome with Hot Twinks Finnegan Harper And Max Carter4:130%

Rough & Raw - Anal Threesome with Hot Twinks Finnegan Harper And Max Carter

Delicious, Harper, Rimming, River

© 2026 JustPornFlix. Adults only.

TermsPrivacyDMCAContact

Adults only · 18+

Welcome to JustPornFlix

This website contains adult material. By entering, you confirm that you are legally permitted to view it in your location.

Leave this website

We could not save your confirmation. Please try again.